PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA87G00136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 205aa    MW: 24029.3 Da    PI: 7.1005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA87G00136genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl
       AA87G00136 15 KGLWTMEEDKILMDYVQSHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 62
                     678*******************************************97 PP

2Myb_DNA-binding53.36.1e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++l+++++k+lG++ W++Ia++++  Rt++q+k++w+++l
       AA87G00136  68 RGNFTDLEEDLIIRLHKLLGNR-WSLIAKRIP-ERTDNQVKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24865IPR009057Homeodomain-like
PROSITE profilePS5129417.6811062IPR017930Myb domain
SuperFamilySSF466892.95E-3013109IPR009057Homeodomain-like
SMARTSM007171.5E-131464IPR001005SANT/Myb domain
PfamPF002491.2E-161562IPR001005SANT/Myb domain
CDDcd001671.91E-101862No hitNo description
PROSITE profilePS5129424.67563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2566117IPR009057Homeodomain-like
SMARTSM007172.4E-1667115IPR001005SANT/Myb domain
PfamPF002499.6E-1668113IPR001005SANT/Myb domain
CDDcd001671.97E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MRKIIREVKD EEYKKGLWTM EEDKILMDYV QSHGQGHWNR IAKKTGLKRC GKSCRLRWMN  60
YLSPNVNRGN FTDLEEDLII RLHKLLGNRW SLIAKRIPER TDNQVKNYWN THLSKKLGLE  120
EHSSVTKPVC DDESTPSILT CTTHQDEKVT ITSFNSVADE FRLNLEPKPD QTTTIPNRFE  180
TFWVLEDEFE LSSLTMMDFT SGSCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-27611718128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010450681.11e-109PREDICTED: transcription factor MYB23
SwissprotQ962761e-104MYB23_ARATH; Transcription factor MYB23
TrEMBLR0F1W91e-107R0F1W9_9BRAS; Uncharacterized protein
STRINGAT5G40330.11e-102(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.11e-105myb domain protein 23